Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative antiporter subunit mnhG2 (mnhG2)

This Recombinant Putative antiporter subunit mnhG2 (mnhG2) spans the amino acid sequence from region 1-145.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhG2, Mrp complex subunit G2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

Q0Q2J4

Expression Region

1-145

Origin

Staphylococcus aureus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATKSSTLSVLLTLIGVLI YFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYRKNDAHTHASILLSSNE QNSTEALQLRAEKREEHRKKWYQND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT6 Antibody
AF6302-01 100 µL

STAT6 Antibody

Sign In for Pricing
View Details
STAT6 Antibody
AF6302-02 200 µL

STAT6 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Hyou1 shRNA (UAS) - Lentiviral mouse Hyou1 shRNA (UAS, iRFP) (25)
GTR15260558 1 Vial

Lentiviral mouse Hyou1 shRNA (UAS) - Lentiviral mouse Hyou1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Mouse Monoclonal PPIL6 Antibody (OTI4F2) [Alexa Fluor 405]
NBP2-73578AF405 0.1 mL

Mouse Monoclonal PPIL6 Antibody (OTI4F2) [Alexa Fluor 405]

Sign In for Pricing
View Details
General 24,25-Dihydroxy Vitamin D3,24,25-DVD3 ELISA KIT
EA0044Ge-01 96 Well

General 24,25-Dihydroxy Vitamin D3,24,25-DVD3 ELISA KIT

Sign In for Pricing
View Details
General 24,25-Dihydroxy Vitamin D3,24,25-DVD3 ELISA KIT
EA0044Ge-02 5x 96 Tests

General 24,25-Dihydroxy Vitamin D3,24,25-DVD3 ELISA KIT

Sign In for Pricing
View Details