Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative antiporter subunit mnhG2 (mnhG2)

This Recombinant Putative antiporter subunit mnhG2 (mnhG2) spans the amino acid sequence from region 1-145.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhG2, Mrp complex subunit G2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

Q0Q2J4

Expression Region

1-145

Origin

Staphylococcus aureus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATKSSTLSVLLTLIGVLI YFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYRKNDAHTHASILLSSNE QNSTEALQLRAEKREEHRKKWYQND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST1H2AE ORF Vector (Human) (pORF)
23316011 1.0 µg DNA

HIST1H2AE ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rabbit Monoclonal MTA2 Antibody (SR2200)
NBP3-21758-100ul 100 µL

Rabbit Monoclonal MTA2 Antibody (SR2200)

Sign In for Pricing
View Details
FAM113B shRNA Plasmid (m)
sc-141580-SH 20 µg

FAM113B shRNA Plasmid (m)

Sign In for Pricing
View Details
Human thrombinthrombomodulin compound (T-TM) ELISA Kit
GA-E1140HM-01 48 Tests

Human thrombinthrombomodulin compound (T-TM) ELISA Kit

Sign In for Pricing
View Details
Human thrombinthrombomodulin compound (T-TM) ELISA Kit
GA-E1140HM-02 96 Tests

Human thrombinthrombomodulin compound (T-TM) ELISA Kit

Sign In for Pricing
View Details
Human Guanidoacetic Acid ELISA kit
GTR10420852 96 Well

Human Guanidoacetic Acid ELISA kit

Sign In for Pricing
View Details