Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein T09E8.3 (T09E8.3)

This Recombinant Uncharacterized protein T09E8.3 (T09E8.3) spans the amino acid sequence from region 1-145.

Product Specifications

Product Name Alternative

Uncharacterized protein T09E8.3

UniProt

Q22361

Expression Region

1-145

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFTFAAFCYLLALIAVGFCIFFAIYTVICVDELRTDYKNPIEQCRNLNQLILPEYIIHG TFTVLFIFSWQLISILANLPLAFYHIYTYAKRPVMSGPGIYDPTTILNRSTLSSTLRISW IKLAFYLVSFFYYLYAMIYTLVTSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF622 (NM_033414) Human Over-expression Lysate
LC403248 20 µg

ZNF622 (NM_033414) Human Over-expression Lysate

Sign In for Pricing
View Details
Tosylurethane
TRC-T686900-1G 1 g

Tosylurethane

Sign In for Pricing
View Details
NLRP4 Polyclonal Antibody
E-AB-16628-01 20 µL

NLRP4 Polyclonal Antibody

Sign In for Pricing
View Details
NLRP4 Polyclonal Antibody
E-AB-16628-02 60 µL

NLRP4 Polyclonal Antibody

Sign In for Pricing
View Details
NLRP4 Polyclonal Antibody
E-AB-16628-03 120 µL

NLRP4 Polyclonal Antibody

Sign In for Pricing
View Details
NLRP4 Polyclonal Antibody
E-AB-16628-04 200 µL

NLRP4 Polyclonal Antibody

Sign In for Pricing
View Details