Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein T09E8.3 (T09E8.3)

This Recombinant Uncharacterized protein T09E8.3 (T09E8.3) spans the amino acid sequence from region 1-145.

Product Specifications

Product Name Alternative

Uncharacterized protein T09E8.3

UniProt

Q22361

Expression Region

1-145

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFTFAAFCYLLALIAVGFCIFFAIYTVICVDELRTDYKNPIEQCRNLNQLILPEYIIHG TFTVLFIFSWQLISILANLPLAFYHIYTYAKRPVMSGPGIYDPTTILNRSTLSSTLRISW IKLAFYLVSFFYYLYAMIYTLVTSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

c-Myb (MYB) Human Gene Knockout Kit (CRISPR)
KN209061LP 1 Kit

c-Myb (MYB) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(2S)-Arimoclomol Maleic Acid
TRC-A771265-1MG 1 mg

(2S)-Arimoclomol Maleic Acid

Sign In for Pricing
View Details
Crude Helix aspersa Lectin (Garden Snail) -HAA-
L-3800-100 100 mg

Crude Helix aspersa Lectin (Garden Snail) -HAA-

Sign In for Pricing
View Details
ATP6J (ATP6V1G1) Rabbit Polyclonal Antibody
TA362368 100 µL

ATP6J (ATP6V1G1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS808803 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
BAFF (TNFSF13B) Rabbit Polyclonal Antibody
AP05831PU-N 100 µg

BAFF (TNFSF13B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details