Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein T09E8.3 (T09E8.3)

This Recombinant Uncharacterized protein T09E8.3 (T09E8.3) spans the amino acid sequence from region 1-145.

Product Specifications

Product Name Alternative

Uncharacterized protein T09E8.3

UniProt

Q22361

Expression Region

1-145

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFTFAAFCYLLALIAVGFCIFFAIYTVICVDELRTDYKNPIEQCRNLNQLILPEYIIHG TFTVLFIFSWQLISILANLPLAFYHIYTYAKRPVMSGPGIYDPTTILNRSTLSSTLRISW IKLAFYLVSFFYYLYAMIYTLVTSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF640R conjugate, 0.1mg/mL
BNC401859-100 1x 100 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RAC1 (NM_006908) Human Recombinant Protein
TP308711M 100 µg

RAC1 (NM_006908) Human Recombinant Protein

Sign In for Pricing
View Details
Glyoxalbis(2-hydroxyanil)
TRC-G252700-2.5G 2.5 g

Glyoxalbis(2-hydroxyanil)

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS520006 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
Cortactin pTyr466 Rabbit Polyclonal Antibody
AP02517PU-S 50 µL

Cortactin pTyr466 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Smoothened (SMO) Rabbit Polyclonal Antibody
AP01508PU-N 100 µg

Smoothened (SMO) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details