Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1354 (MJ1354)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1354 (MJ1354) spans the amino acid sequence from region 1-145.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1354

UniProt

Q58749

Expression Region

1-145

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVGIILGILSAMGFLVFLGIGGHILIGYEIIRKISKAYEKGEDVKELENKIINKSHLTN TLEKITTFTLTSIFLFEMEKYRYVIDVGYSILFLVTLTLYLVPNLSLLVWVTFFGATVFM IMLWILRFRAIKEFNKAFIEELTTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4-Dichlorofluorobenzene
TRC-D438810-500MG 500 mg

2,4-Dichlorofluorobenzene

Sign In for Pricing
View Details
MMAB Antibody
KC-2012-01 50 μL

MMAB Antibody

Sign In for Pricing
View Details
MMAB Antibody
KC-2012-02 100 µL

MMAB Antibody

Sign In for Pricing
View Details
MMAB Antibody
KC-2012-03 1 mL

MMAB Antibody

Sign In for Pricing
View Details
Polyoxyl 35 Castor Oil
TRC-P689395-50G 50 g

Polyoxyl 35 Castor Oil

Sign In for Pricing
View Details
EGFR pTyr1197 Rabbit Polyclonal Antibody
AP02486PU-N 100 µL

EGFR pTyr1197 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details