Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Nitric oxide reductase subunit C (norC)

This Recombinant Pseudomonas aeruginosa Nitric oxide reductase subunit C (norC) spans the amino acid sequence from region 2-146.

Product Specifications

Product Name Alternative

Nitric oxide reductase subunit C, NOR small subunit, Nitric oxide reductase cytochrome c subunit

UniProt

Q59646

Expression Region

2-146

Origin

Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SETFTKGMARNIYFGGSVFFILLFLALTYHTEKTLPERTNEAAMSAAVVRGKLVWEQNNC VGCHTLLGEGAYFAPELGNVVGRRGGEEGFNTFLQAWMNIQPLNVPGRRAMPQFHLSEGQ VDDLAEFLKWSSKIDTNQWPPNKEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-100 1x 100 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF594 conjugate, 0.1mg/mL
BNC940324-100 1x 100 µL

CD53 (161-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF740 conjugate, 0.1mg/mL
BNC740978-100 1x 100 µL

CD7 (T3-3A1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
BNC550017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL
BNC880304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details