Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas stutzeri Nitric oxide reductase subunit C (norC)

This Recombinant Pseudomonas stutzeri Nitric oxide reductase subunit C (norC) spans the amino acid sequence from region 2-146.

Product Specifications

Product Name Alternative

Nitric oxide reductase subunit C, NOR small subunit, Nitric oxide reductase cytochrome c subunit

UniProt

Q52527

Expression Region

2-146

Origin

Pseudomonas stutzeri (Pseudomonas perfectomarina)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SETFTKGMARNIYFGGSVFFFLVFLGLTYHTEQTFPERTNESEMTEAVVRGKEVWENNNC IGCHSLLGEGAYFAPELGNVFVRRGGEETFKPFLHAWMKAQPLGAPGRRAMPQFNLSEQQ VDDMAEFLKWTSKIDTNDWPPNKEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Catalase (CAT) Goat Polyclonal Antibody
AB0245-200 600 µg

Catalase (CAT) Goat Polyclonal Antibody

Sign In for Pricing
View Details
NIT2 (NM_020202) Human Over-expression Lysate
LY402761 100 µg

NIT2 (NM_020202) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS638337 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
SETDB1 (C-term) Rabbit Polyclonal Antibody
AP11091PU-N 400 µL

SETDB1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human BMT2 activation kit by CRISPRa
GA115895 1 Kit

Human BMT2 activation kit by CRISPRa

Sign In for Pricing
View Details
1-Cyclopropyl-6,7,8-trifluoro-1,4-dihydro-4-oxo-3-quinolinecarboxylic Acid Anhydride with Diacetyl Borate
TRC-C989045-50MG 50 mg

1-Cyclopropyl-6,7,8-trifluoro-1,4-dihydro-4-oxo-3-quinolinecarboxylic Acid Anhydride with Diacetyl Borate

Sign In for Pricing
View Details