Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas stutzeri Nitric oxide reductase subunit C (norC)

This Recombinant Pseudomonas stutzeri Nitric oxide reductase subunit C (norC) spans the amino acid sequence from region 2-146.

Product Specifications

Product Name Alternative

Nitric oxide reductase subunit C, NOR small subunit, Nitric oxide reductase cytochrome c subunit

UniProt

Q52527

Expression Region

2-146

Origin

Pseudomonas stutzeri (Pseudomonas perfectomarina)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SETFTKGMARNIYFGGSVFFFLVFLGLTYHTEQTFPERTNESEMTEAVVRGKEVWENNNC IGCHSLLGEGAYFAPELGNVFVRRGGEETFKPFLHAWMKAQPLGAPGRRAMPQFNLSEQQ VDDMAEFLKWTSKIDTNDWPPNKEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTDSS2 Human Gene Knockout Kit (CRISPR)
KN400996 1 Kit

PTDSS2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MMP2 Antibody
KC-6428-01 50 μL

MMP2 Antibody

Sign In for Pricing
View Details
MMP2 Antibody
KC-6428-02 100 µL

MMP2 Antibody

Sign In for Pricing
View Details
MMP2 Antibody
KC-6428-03 1 mL

MMP2 Antibody

Sign In for Pricing
View Details
SMAD1 (NM_001003688) Human Over-expression Lysate
LY424106 100 µg

SMAD1 (NM_001003688) Human Over-expression Lysate

Sign In for Pricing
View Details
Tbc1d14 Mouse Gene Knockout Kit (CRISPR)
KN517239 1 Kit

Tbc1d14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details