Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhG2 (mnhG2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhG2 (mnhG2) spans the amino acid sequence from region 1-145.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhG2, Mrp complex subunit G2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

Q7A722

Expression Region

1-145

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATKSSTLSVLLTLIGVLI YFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYRKNDAHTHASILLSSNE QNSTEALQLRAKKREEHRKKWYQND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KPNB1 Recombinant Rabbit Monoclonal Antibody [PSH01-60]
HA721703 100 µL

KPNB1 Recombinant Rabbit Monoclonal Antibody [PSH01-60]

Sign In for Pricing
View Details
HOXC11 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B8]
TA502573BM 100 µL

HOXC11 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B8]

Sign In for Pricing
View Details
CALCA Antibody
KC-1690-01 50 μL

CALCA Antibody

Sign In for Pricing
View Details
CALCA Antibody
KC-1690-02 100 µL

CALCA Antibody

Sign In for Pricing
View Details
CALCA Antibody
KC-1690-03 1 mL

CALCA Antibody

Sign In for Pricing
View Details
Human NEURL3 activation kit by CRISPRa
GA114261 1 Kit

Human NEURL3 activation kit by CRISPRa

Sign In for Pricing
View Details