Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhG2 (mnhG2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhG2 (mnhG2) spans the amino acid sequence from region 1-145.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhG2, Mrp complex subunit G2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

Q6GBK1

Expression Region

1-145

Origin

Staphylococcus aureus (strain MSSA476)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATKSSTLSVLLTLIGVLI YFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYRKNDAHTHASILLSSNE QNSTEALQLRAEKREEHRKKWYQND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,4-Di-O-acetyl-2-azido-2-deoxy-D-glucopyranose
GC2610-250mg 250 mg

3,4-Di-O-acetyl-2-azido-2-deoxy-D-glucopyranose

Sign In for Pricing
View Details
λ-crystallin CRISPR Activation Plasmid (h2)
sc-412108-ACT-2 20 µg

λ-crystallin CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Plk5, NT (Plk5, Inactive serine/threonine-protein kinase PLK5, Polo-like kinase 5) (APC) discontinued
040177-APC 200 µL

Plk5, NT (Plk5, Inactive serine/threonine-protein kinase PLK5, Polo-like kinase 5) (APC) discontinued

Sign In for Pricing
View Details
Guinea Pig Cardiotrophln 1
GTR10389462 96 Well

Guinea Pig Cardiotrophln 1

Sign In for Pricing
View Details
RANGAP1 Conjugated Antibody
MBS9443910-01 0.1 mL (Biotin)

RANGAP1 Conjugated Antibody

Sign In for Pricing
View Details
RANGAP1 Conjugated Antibody
MBS9443910-02 0.1 mL (AF350)

RANGAP1 Conjugated Antibody

Sign In for Pricing
View Details