Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhG2 (mnhG2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhG2 (mnhG2) spans the amino acid sequence from region 1-145.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhG2, Mrp complex subunit G2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

Q99VY6

Expression Region

1-145

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATKSSTLSVLLTLIGVLI YFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYRKNDAHTHASILLSSNE QNSTEALQLRAKKREEHRKKWYQND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRGPRG Recombinant Protein (Mouse)
RP151442 100 µg

MRGPRG Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Phaseolus vulgaris Lectin (PHA-L) - HRP (Horseradish Peroxidase)
30330034-1 2 mg

Phaseolus vulgaris Lectin (PHA-L) - HRP (Horseradish Peroxidase)

Sign In for Pricing
View Details
Anti-Rat Connexin 33 (Cx33) antiserum #1
CX33-S 100 µL

Anti-Rat Connexin 33 (Cx33) antiserum #1

Sign In for Pricing
View Details
D-Arabitol-d7
HY-W711807 1 Each

D-Arabitol-d7

Sign In for Pricing
View Details
SARS-CoV-2 (COVID-19) Nucleoprotein
497212-01 100 µg

SARS-CoV-2 (COVID-19) Nucleoprotein

Sign In for Pricing
View Details
SARS-CoV-2 (COVID-19) Nucleoprotein
497212-02 200 µg

SARS-CoV-2 (COVID-19) Nucleoprotein

Sign In for Pricing
View Details