Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b (cob)

This Recombinant Cytochrome b (cob) spans the amino acid sequence from region 1-145.

Product Specifications

Product Name Alternative

Cytochrome b, Complex III subunit 3, Complex III subunit III, Cytochrome b-c1 complex subunit 3, Ubiquinol-cytochrome-c reductase complex cytochrome b subunit

UniProt

P56629

Expression Region

1-145

Origin

Aspergillus flavus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

WGATVITNLMSAIPWIGQDIVEFIWGGFSVNNATLNRFFALHFLLPFVLAALALMHLIAM HDTVGSGNPLGISGNYDRLPFAPYFIFKDLVTIFIFFIVLSIFVFFMPNALGDSENYVMA NPMQTPPAIVPEWYLLPFYAILRSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRPV4 Recombinant Rabbit monoclonal Antibody
HA751600 100 µL

TRPV4 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
4-Hydroxy Fenofibric Acid
TRC-H942745-50MG 50 mg

4-Hydroxy Fenofibric Acid

Sign In for Pricing
View Details
Ceftiofur-D3
TRC-C244703-1MG 1 mg

Ceftiofur-D3

Sign In for Pricing
View Details
CD56 (NCAM1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C7]
TA804952AM 100 µL

CD56 (NCAM1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C7]

Sign In for Pricing
View Details
OTOA (NM_001161683) Human Over-expression Lysate
LC431663 20 µg

OTOA (NM_001161683) Human Over-expression Lysate

Sign In for Pricing
View Details
Zfand2a Mouse Gene Knockout Kit (CRISPR)
KN519703 1 Kit

Zfand2a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details