Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b (cob)

This Recombinant Cytochrome b (cob) spans the amino acid sequence from region 1-145.

Product Specifications

Product Name Alternative

Cytochrome b, Complex III subunit 3, Complex III subunit III, Cytochrome b-c1 complex subunit 3, Ubiquinol-cytochrome-c reductase complex cytochrome b subunit

UniProt

P56629

Expression Region

1-145

Origin

Aspergillus flavus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

WGATVITNLMSAIPWIGQDIVEFIWGGFSVNNATLNRFFALHFLLPFVLAALALMHLIAM HDTVGSGNPLGISGNYDRLPFAPYFIFKDLVTIFIFFIVLSIFVFFMPNALGDSENYVMA NPMQTPPAIVPEWYLLPFYAILRSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurofilament (NF-L) (NFL/736), CF405S conjugate, 0.1mg/mL
BNC040736-100 1x 100 µL

Neurofilament (NF-L) (NFL/736), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PSORS1C2 activation kit by CRISPRa
GA116219 1 Kit

Human PSORS1C2 activation kit by CRISPRa

Sign In for Pricing
View Details
EGTT-Scavenger for GSH/GSSG Assays (EGTT-100)
EGTT-SCVG 100 Tests

EGTT-Scavenger for GSH/GSSG Assays (EGTT-100)

Sign In for Pricing
View Details
Chrm2 Mouse Gene Knockout Kit (CRISPR)
KN503299 1 Kit

Chrm2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TNFRSF9 Antibody Pair Set
E-KAB-0412 50 µL & 100 µg

Human TNFRSF9 Antibody Pair Set

Sign In for Pricing
View Details
Human DPEP3 activation kit by CRISPRa
GA112008 1 Kit

Human DPEP3 activation kit by CRISPRa

Sign In for Pricing
View Details