Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhG2 (mnhG2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhG2 (mnhG2) spans the amino acid sequence from region 1-145.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhG2, Mrp complex subunit G2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

P0C947

Expression Region

1-145

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATKSSTLSVLLTLIGVLI YFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYRKNDDHTHASILLSSNE QNSTKALQLRAKKREEYRKKWYQND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-4 / Interleukin 4 (IL4/1597), CF647 conjugate, 0.1mg/mL
BNC471597-100 1x 100 µL

IL-4 / Interleukin 4 (IL4/1597), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tislelizumab Biosimilar - Research Grade
ICH5004-50mg 50 mg

Tislelizumab Biosimilar - Research Grade

Sign In for Pricing
View Details
GCNT1 (NM_001097636) Human Over-expression Lysate
LY420411 100 µg

GCNT1 (NM_001097636) Human Over-expression Lysate

Sign In for Pricing
View Details
E,E-Dienestrol
TRC-D441810-50MG 50 mg

E,E-Dienestrol

Sign In for Pricing
View Details
Anti-ISLR
Y058879 100 µg

Anti-ISLR

Sign In for Pricing
View Details
Colec10 Mouse Gene Knockout Kit (CRISPR)
KN503657 1 Kit

Colec10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details