Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Late protein H7 (VACWR105)

This Recombinant Vaccinia virus Late protein H7 (VACWR105) spans the amino acid sequence from region 1-146.

Product Specifications

Product Name Alternative

Late protein H7, Protein H8

UniProt

P08586

Expression Region

1-146

Origin

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEMDKRMKSLAMTAFFGELSTLDIMALIMSIFKRHPNNTIFSVDKDGQFMIDFEYDNYKA SQYLDLTLTPISGDECKTHASSIAEQLACVDIIKEDISEYIKTTPRLKRFIKKYRNRSDT RISRDTEKLKIALAKGIDYEYIKDAC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
BNC680031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
BNC880009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
BNC040460-100 1x 100 µL

CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF594 conjugate, 0.1mg/mL
BNC940324-100 1x 100 µL

CD53 (161-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD19 (CVID3/429), CF568 conjugate, 0.1mg/mL
BNC680429-500 1x 500 µL

CD19 (CVID3/429), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF488A conjugate, 0.1mg/mL
BNC880345-100 1x 100 µL

CD4 (EDU-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details