Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Large-conductance mechanosensitive channel (mscL)

This Recombinant Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-146.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q67PL7

Expression Region

1-146

Origin

Symbiobacterium thermophilum

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSEFKRFALRGNVLDLAVGVVIGAAFNQIVNSLVNDVIMPPLGFLVGKMDFSNLYLNLS LTPYASLAEAREAGAPVIAYGLFLNNLLNFLIVAFAVFLLVRQVNRWRPTPPPEPPKTKE CPYCLSTVPVKATRCAHCTSDLTAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cell Meter™ Fluorimetric Intracellular Total ROS Activity Assay Kit*Orange Fluorescence*
22902-AAT 200 Tests

Cell Meter™ Fluorimetric Intracellular Total ROS Activity Assay Kit*Orange Fluorescence*

Sign In for Pricing
View Details
RAMP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E5]
TA504410BM 100 µL

RAMP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E5]

Sign In for Pricing
View Details
Human IL-1 beta Recombinant Rabbit monoclonal Antibody
HA723881 100 µL

Human IL-1 beta Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Spinosyn B
TRC-S681960-2.5MG 2.5 mg

Spinosyn B

Sign In for Pricing
View Details
1,1'-Carbonyldiimidazole (>90%)
TRC-C177005-25G 25 g

1,1'-Carbonyldiimidazole (>90%)

Sign In for Pricing
View Details
D,L-Mevalonic Acid Lactone-d3
TRC-M339027-1MG 1 mg

D,L-Mevalonic Acid Lactone-d3

Sign In for Pricing
View Details