Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Large-conductance mechanosensitive channel (mscL)

This Recombinant Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-146.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q67PL7

Expression Region

1-146

Origin

Symbiobacterium thermophilum

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSEFKRFALRGNVLDLAVGVVIGAAFNQIVNSLVNDVIMPPLGFLVGKMDFSNLYLNLS LTPYASLAEAREAGAPVIAYGLFLNNLLNFLIVAFAVFLLVRQVNRWRPTPPPEPPKTKE CPYCLSTVPVKATRCAHCTSDLTAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS705953 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Chromogranin A (CHGA) Mouse Monoclonal Antibody [Clone ID: SPM553]
AM50101PU-S 100 µg

Chromogranin A (CHGA) Mouse Monoclonal Antibody [Clone ID: SPM553]

Sign In for Pricing
View Details
Atf3 (NM_007498) Mouse Tagged ORF Clone
MG201634 10 µg

Atf3 (NM_007498) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF568 conjugate, 0.1mg/mL
BNC682488-500 1x 500 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
16S V2-V3 Library Preparation Kit for Illumina (Set D)
70340 96 Preparations

16S V2-V3 Library Preparation Kit for Illumina (Set D)

Sign In for Pricing
View Details
2-(3-Chlorophenyl)pyrimidine-4-carboxylic Acid
TRC-C171361-500MG 500 mg

2-(3-Chlorophenyl)pyrimidine-4-carboxylic Acid

Sign In for Pricing
View Details