Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yarrowia lipolytica Assembly factor CBP4 (CBP4)

This Recombinant Yarrowia lipolytica Assembly factor CBP4 (CBP4) spans the amino acid sequence from region 1-146.

Product Specifications

Product Name Alternative

Assembly factor CBP4, Cytochrome b mRNA-processing protein 4

UniProt

Q6C5S0

Expression Region

1-146

Origin

Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRLENWPIVEMFRSRPGVPNWPKFGLFAVGVIGSAYLGYRYATPSEEDIVRRMNPELRER YMLERDARQEYFNEFVKEAIAQSKTNEPIWKVGPMASKPIDFNVAVREKMKEIEARNDQD RNERIKNELAAIAKKEEEEKNKKGWW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL
BNC040149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF647 conjugate, 0.1mg/mL
BNC470160-500 1x 500 µL

CD20 (B9E9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF568 conjugate, 0.1mg/mL
BNC680012-100 1x 100 µL

Tyrosinase (T311), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL
BNC880745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF405S conjugate, 0.1mg/mL
BNC040345-100 1x 100 µL

CD4 (EDU-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/1190), CF740 conjugate, 0.1mg/mL
BNC741190-500 1x 500 µL

Cytokeratin 18 (KRT18/1190), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details