Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Neuropeptide Y receptor type 2 (NPY2R)

This Recombinant Sheep Neuropeptide Y receptor type 2 (NPY2R) spans the amino acid sequence from region 1-146.

Product Specifications

Product Name Alternative

Neuropeptide Y receptor type 2, NPY2-R, NPY-Y2 receptor, Y2 receptor

UniProt

P79211

Expression Region

1-146

Origin

Ovis aries (Sheep)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKQISFLIIGLAWGVS ALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKGIYGTVYSLLSLLILYVLPLGIIS FSYARIWSKLKNHVSPGAAHDHYHQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MtTFA Antibody, mAb, Rabbit
A03979-100 100 µL

MtTFA Antibody, mAb, Rabbit

Sign In for Pricing
View Details
CEF pool (extended) -70%
RP30947-6.4 1 Vial (0.2 mg/Peptide)

CEF pool (extended) -70%

Sign In for Pricing
View Details
ReadiUse™ 4% formaldehyde fixation solution
20010-AAT 50 mL

ReadiUse™ 4% formaldehyde fixation solution

Sign In for Pricing
View Details
DNMBP Knockout MES-OV Polyclonal Cells
ARG39423 1 Million

DNMBP Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details
pCDNA3.0-FLAG-N Plasmid
PVT16109 2 µg

pCDNA3.0-FLAG-N Plasmid

Sign In for Pricing
View Details
Rat Mitf Pre-designed siRNA Set B
SI208470B 1 Each

Rat Mitf Pre-designed siRNA Set B

Sign In for Pricing
View Details