Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Neuropeptide Y receptor type 2 (NPY2R)

This Recombinant Sheep Neuropeptide Y receptor type 2 (NPY2R) spans the amino acid sequence from region 1-146.

Product Specifications

Product Name Alternative

Neuropeptide Y receptor type 2, NPY2-R, NPY-Y2 receptor, Y2 receptor

UniProt

P79211

Expression Region

1-146

Origin

Ovis aries (Sheep)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKQISFLIIGLAWGVS ALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKGIYGTVYSLLSLLILYVLPLGIIS FSYARIWSKLKNHVSPGAAHDHYHQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Acetyl-CoA carboxylase 1 (ACACA), partial
orb1785399-01 20 µg

Recombinant Human Acetyl-CoA carboxylase 1 (ACACA), partial

Sign In for Pricing
View Details
Recombinant Human Acetyl-CoA carboxylase 1 (ACACA), partial
orb1785399-02 100 µg

Recombinant Human Acetyl-CoA carboxylase 1 (ACACA), partial

Sign In for Pricing
View Details
Recombinant Human Acetyl-CoA carboxylase 1 (ACACA), partial
orb1785399-03 1 mg

Recombinant Human Acetyl-CoA carboxylase 1 (ACACA), partial

Sign In for Pricing
View Details
Osteoblast Activating Peptide (OBAP) (Rat, Mouse) - RIA Kit
RK-055-51 125 Tubes

Osteoblast Activating Peptide (OBAP) (Rat, Mouse) - RIA Kit

Sign In for Pricing
View Details
Human Serine Peptidase Inhibitor Kazal Type 5 (SPINK5) ELISA Kit
DLR-SPINK5-Hu-96T 96 Tests

Human Serine Peptidase Inhibitor Kazal Type 5 (SPINK5) ELISA Kit

Sign In for Pricing
View Details
Dlgap2 3'UTR GFP Stable Cell Line
TU253448 1.0 mL

Dlgap2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details