Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Neuropeptide Y receptor type 2 (NPY2R)

This Recombinant Sheep Neuropeptide Y receptor type 2 (NPY2R) spans the amino acid sequence from region 1-146.

Product Specifications

Product Name Alternative

Neuropeptide Y receptor type 2, NPY2-R, NPY-Y2 receptor, Y2 receptor

UniProt

P79211

Expression Region

1-146

Origin

Ovis aries (Sheep)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKQISFLIIGLAWGVS ALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKGIYGTVYSLLSLLILYVLPLGIIS FSYARIWSKLKNHVSPGAAHDHYHQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CALM1 CRISPRa sgRNA lentivector (set of three targets)(Human)
14932121 3x 1.0µg DNA

CALM1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Mitochondrial import inner membrane translocase subunit tim44 (tim44), partial
MBS1069482 Inquire

Recombinant Schizosaccharomyces pombe Mitochondrial import inner membrane translocase subunit tim44 (tim44), partial

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Cadherin-86C (Cad86C), partial
MBS1371407 Inquire

Recombinant Drosophila melanogaster Cadherin-86C (Cad86C), partial

Sign In for Pricing
View Details
NEU4 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
31732064 1.0 µg DNA

NEU4 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
BCCIP 3'UTR GFP Stable Cell Line
TU051685 1.0 mL

BCCIP 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Srp54b (NM_001100109) Mouse Untagged Clone
MC217243 10 µg

Srp54b (NM_001100109) Mouse Untagged Clone

Sign In for Pricing
View Details