Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizopus oryzae FK506-binding protein 2A (FKBP2)

This Recombinant Rhizopus oryzae FK506-binding protein 2A (FKBP2) spans the amino acid sequence from region 22-167.

Product Specifications

Product Name Alternative

FK506-binding protein 2A, EC= 5.2.1.8, Peptidyl-prolyl cis-trans isomerase, PPIase, Rotamase

UniProt

P0C1J4

Expression Region

22-167

Origin

Rhizopus oryzae (Rhizopus delemar)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AKSESTINKPEKCGLKASSSSTVRIHYRSRVWGQEEYFESTYIREAPLEVKLGNGNLLKG IEDGIHGMCTGEIRRLLIPPNQAYGAIGIPNLVPPNTAIVVDVEMVNVNSPFSLWFWISG LILFSAFLLFGRKPIKGDTSNIKKKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL
BNC040181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
BNC940270-500 1x 500 µL

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL
BNC470994-100 1x 100 µL

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (LK2H10), CF405S conjugate, 0.1mg/mL
BNC040641-500 1x 500 µL

Chromogranin A (LK2H10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (Dendritic Cells Maturation Marker) (rC86/1146), CF405S conjugate, 0.1mg/mL
BNC042083-100 1x 100 µL

CD86 (Dendritic Cells Maturation Marker) (rC86/1146), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF740 conjugate, 0.1mg/mL
BNC742171-500 1x 500 µL

Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details