Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ypbF (ypbF)

This Recombinant Bacillus subtilis Uncharacterized protein ypbF (ypbF) spans the amino acid sequence from region 1-147.

Product Specifications

Product Name Alternative

Uncharacterized protein ypbF

UniProt

P50732

Expression Region

1-147

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESLWNQLDQFTDAPTKQMLQALVKRKQKFENYAAQCRRWRWASLICLGLLCVMIMIKSP EPQLILQEILSHTFYLFWMLATAFAYCTSYYFKKKEEKSETDFHKLRCEIIQKSTDLWPQ PDKWKARESVFHMMKHKYDINLYFESK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

URG4 (Up-regulated Gene 4, DKFZp666G166, DKFZp686O0457)
588810 50 µg

URG4 (Up-regulated Gene 4, DKFZp666G166, DKFZp686O0457)

Sign In for Pricing
View Details
S100A3 Recombinant Protein
OPCD06789-50UG 50 µg

S100A3 Recombinant Protein

Sign In for Pricing
View Details
PerCP-Cy5.5 anti-mouse CD206 (MMR)
E16FMS206-025U 25 µg

PerCP-Cy5.5 anti-mouse CD206 (MMR)

Sign In for Pricing
View Details
BARD1 Antibody
orb1258852 100 µL

BARD1 Antibody

Sign In for Pricing
View Details
Mrpl1 (NM_001039084) Mouse Tagged Lenti ORF Clone
MR218191L3 10 µg

Mrpl1 (NM_001039084) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
UBE2C protein (His tag)
80R-2425 0.1 mg

UBE2C protein (His tag)

Sign In for Pricing
View Details