Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ypbF (ypbF)

This Recombinant Bacillus subtilis Uncharacterized protein ypbF (ypbF) spans the amino acid sequence from region 1-147.

Product Specifications

Product Name Alternative

Uncharacterized protein ypbF

UniProt

P50732

Expression Region

1-147

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESLWNQLDQFTDAPTKQMLQALVKRKQKFENYAAQCRRWRWASLICLGLLCVMIMIKSP EPQLILQEILSHTFYLFWMLATAFAYCTSYYFKKKEEKSETDFHKLRCEIIQKSTDLWPQ PDKWKARESVFHMMKHKYDINLYFESK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Focal Adhesion Kinase ELISA kit
GTR10387455 96 Well

Goat Focal Adhesion Kinase ELISA kit

Sign In for Pricing
View Details
MX1, ID (MX1, Interferon-induced GTP-binding protein Mx1, Interferon-induced protein p78, Interferon-regulated resistance GTP-binding protein MxA, Myxoma resistance protein 1, Myxovirus resistance protein 1, Interferon-induced GTP-binding protein Mx1, N-terminally processed) (Biotin) discontinued
038707-Biotin 200 µL

MX1, ID (MX1, Interferon-induced GTP-binding protein Mx1, Interferon-induced protein p78, Interferon-regulated resistance GTP-binding protein MxA, Myxoma resistance protein 1, Myxovirus resistance protein 1, Interferon-induced GTP-binding protein Mx1, N-terminally processed) (Biotin) discontinued

Sign In for Pricing
View Details
HS3ST2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
23911066 1.0 µg DNA

HS3ST2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Sheep Interleukin 22, IL-22 ELISA KIT
JOT-EK0278Sh-01 96 Well

Sheep Interleukin 22, IL-22 ELISA KIT

Sign In for Pricing
View Details
Sheep Interleukin 22, IL-22 ELISA KIT
JOT-EK0278Sh-02 48 Well

Sheep Interleukin 22, IL-22 ELISA KIT

Sign In for Pricing
View Details
YjhD Antibody
orb836088 2 mg

YjhD Antibody

Sign In for Pricing
View Details