Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ypbF (ypbF)

This Recombinant Bacillus subtilis Uncharacterized protein ypbF (ypbF) spans the amino acid sequence from region 1-147.

Product Specifications

Product Name Alternative

Uncharacterized protein ypbF

UniProt

P50732

Expression Region

1-147

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESLWNQLDQFTDAPTKQMLQALVKRKQKFENYAAQCRRWRWASLICLGLLCVMIMIKSP EPQLILQEILSHTFYLFWMLATAFAYCTSYYFKKKEEKSETDFHKLRCEIIQKSTDLWPQ PDKWKARESVFHMMKHKYDINLYFESK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Sars Membrane Protein Antibody [FITC]
NBP2-41060F 0.1 mL

Rabbit Polyclonal Sars Membrane Protein Antibody [FITC]

Sign In for Pricing
View Details
Lentiviral mouse Tek shRNA (UAS) - Lentiviral mouse Tek shRNA (UAS, iRFP) (25)
GTR15200222 1 Vial

Lentiviral mouse Tek shRNA (UAS) - Lentiviral mouse Tek shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Lentiviral human GFI1B sgRNA gene knockout kit - Lentiviral human GFI1B sgRNA gene knockout kit (100)
GTR15371527 1 Vial

Lentiviral human GFI1B sgRNA gene knockout kit - Lentiviral human GFI1B sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
PFDN3 (VBP1) Mouse Monoclonal Antibody [Clone ID: UMAB75]
UM500063 100 µL

PFDN3 (VBP1) Mouse Monoclonal Antibody [Clone ID: UMAB75]

Sign In for Pricing
View Details
Adintrevimab Biosimilar - Research Grade
ICH5329-50mg 50 mg

Adintrevimab Biosimilar - Research Grade

Sign In for Pricing
View Details
Rat Cortisol (Cortisol) ELISA Kit
E111190 1 Each

Rat Cortisol (Cortisol) ELISA Kit

Sign In for Pricing
View Details