Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Geobacter sp. Large-conductance mechanosensitive channel (mscL)

This Recombinant Geobacter sp. Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-147.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

B9M9E4

Expression Region

1-147

Origin

Geobacter sp. (strain FRC-32)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFKEFKEFAVKGNAVDLAVGVIIGAAFGKIVTSLVNDILMPPLGLLTGKMDFSNLFINLS GTPVDTVAKAKAAGIPTINYGLFFNNIIDFVLVAFSVFLVVKQINRLRRPETPPPPSTRQ CPFCLSPIPLAASRCPQCTSAVEPTAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF488A conjugate, 0.1mg/mL
BNC880164-100 1x 100 µL

CD28 (204.12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
BNC400977-500 1x 500 µL

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405M conjugate, 0.1mg/mL
BNC050322-100 1x 100 µL

CD3e (RIV9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL
BNC040437-500 1x 500 µL

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF647 conjugate, 0.1mg/mL
BNC472993-100 1x 100 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1486), CF640R conjugate, 0.1mg/mL
BNC401486-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1486), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details