Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Plasminogen receptor (KT)

This Recombinant Rat Plasminogen receptor (KT) spans the amino acid sequence from region 1-147.

Product Specifications

Product Name Alternative

Plasminogen receptor (KT), Plg-R (KT)

UniProt

D4ACN8

Expression Region

1-147

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGFIFSKSMNENMKNQQEFMVMHARLQLERQLIMQNEMRERQMAMQIAWSREFLKYFGTF FGIATISLAAGAIKRKKPAFLIPIVPLSFIFTYQYDLGYGTLLQRMKSEAEDILETEKTK LELPKGLITFESLEKARREQSKFFSDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBC1D14 (NM_020773) Human Untagged Clone
SC107053 10 µg

TBC1D14 (NM_020773) Human Untagged Clone

Sign In for Pricing
View Details
COG7 (G-1) AC
sc-271699 AC 500 µg/mL - 25% ag

COG7 (G-1) AC

Sign In for Pricing
View Details
Rabbit Anti-CKB Antibody (MOFY-0722-FY142)
MOFY-0722-FY142 Each

Rabbit Anti-CKB Antibody (MOFY-0722-FY142)

Sign In for Pricing
View Details
Anti-ETBR2 GPR37L1 Antibody
A11679 100 µL

Anti-ETBR2 GPR37L1 Antibody

Sign In for Pricing
View Details
Anti-SOX9 Antibody Picoband® Fluoro550 Conjugated
A00177-3-Fluoro550 100 µg/Vial

Anti-SOX9 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
GPR128 Protein Lysate (Human) with C-Ha Tag
22500031 100 µg

GPR128 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details