Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrococcus horikoshii Uncharacterized protein PH2001 (PH2001)

This Recombinant Pyrococcus horikoshii Uncharacterized protein PH2001 (PH2001) spans the amino acid sequence from region 1-147.

Product Specifications

Product Name Alternative

Uncharacterized protein PH2001

UniProt

O57781

Expression Region

1-147

Origin

Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLVIVGGTTTGILFLGPRYLPRYLPILGINGASAMKKSYFLANFLACLGLLAISSSSALL ITSSPSLLAASATAPSAMTAIFTSFPLPWGSTTSSLNLFSGRLRSISLRFTATSTLCVKL RGLARALASFTASTIFCLSKAILDIPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCGR Antibody
CSB-PA002705-01 50 µg

GCGR Antibody

Sign In for Pricing
View Details
GCGR Antibody
CSB-PA002705-02 100 µg

GCGR Antibody

Sign In for Pricing
View Details
APOA4 Antibody
MBS8589469-01 0.1 mg

APOA4 Antibody

Sign In for Pricing
View Details
APOA4 Antibody
MBS8589469-02 0.1 mL (AF405L)

APOA4 Antibody

Sign In for Pricing
View Details
APOA4 Antibody
MBS8589469-03 0.1 mL (AF405S)

APOA4 Antibody

Sign In for Pricing
View Details
APOA4 Antibody
MBS8589469-04 0.1 mL (AF610)

APOA4 Antibody

Sign In for Pricing
View Details