Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Chemotaxis inhibitory protein (chp)

Product Specifications

Product Name Alternative

(CHIPS)

Abbreviation

Recombinant Staphylococcus aureus chp protein

Gene Name

Chp

UniProt

Q2FWV5

Expression Region

29-149aa

Organism

Staphylococcus aureus (strain NCTC 8325 / PS 47)

Target Sequence

FTFEPFPTNEEIESNKKLLEKEKAYKESFKNSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Involved in countering the first line of host defense mechanisms. Specifically inhibits the response of human neutrophils and monocytes to complement anaphylatoxin C5a and formylated peptides, like N-formyl-methionyl-leucyl-phenylalanine (fMLP) . Acts by binding directly to the C5a receptor (C5aR) and formylated peptide receptor (FPR), thereby blocking the C5a- and fMLP-induced calcium responses. Prevents phagocytosis of the bacterium.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.5 kDa

References & Citations

"The Staphylococcus aureus NCTC 8325 genome." Gillaspy A.F., Worrell V., Orvis J., Roe B.A., Dyer D.W., Iandolo J.J. (In) Fischetti V., Novick R., Ferretti J., Portnoy D., Rood J. (eds.) ; Gram positive pathogens, 2nd edition, pp.381-412, ASM Press, Washington D.C. (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXOC1 (NM_001024924) Human Over-expression Lysate
LY422553 100 µg

EXOC1 (NM_001024924) Human Over-expression Lysate

Sign In for Pricing
View Details
3-Nonyne
TRC-N650415-500MG 500 mg

3-Nonyne

Sign In for Pricing
View Details
Mouse Kif16b activation kit by CRISPRa
GA202298 1 Kit

Mouse Kif16b activation kit by CRISPRa

Sign In for Pricing
View Details
DNA PKcs Recombinant Rabbit monoclonal Antibody [SC57-08]
ET1610-12-50UL 50 µL

DNA PKcs Recombinant Rabbit monoclonal Antibody [SC57-08]

Sign In for Pricing
View Details
APPL Antibody
KC-2703-01 50 μL

APPL Antibody

Sign In for Pricing
View Details
APPL Antibody
KC-2703-02 100 µL

APPL Antibody

Sign In for Pricing
View Details