Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Corynebacterium glutamicum Uncharacterized membrane protein Cgl2017/cg2211 (Cgl2017, cg2211)

This Recombinant Corynebacterium glutamicum Uncharacterized membrane protein Cgl2017/cg2211 (Cgl2017, cg2211) spans the amino acid sequence from region 1-147.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein Cgl2017/cg2211, P20

UniProt

Q8NP09

Expression Region

1-147

Origin

Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGSSHTIEPEIYRGVSTLDEPSAAWGWHGLKRNTIQLAGWISVLFMLGYNFGNHKGHVE TIWLLVITALLVIGLLIHLFEPKLSQVRTITSRNKPVGHVEPDWTYDQATLTGTWGNLTD SQLRSVNIEPSRVAHLRAADSAKELDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM90A18P (NM_001164451) Human Over-expression Lysate
LY431410 100 µg

FAM90A18P (NM_001164451) Human Over-expression Lysate

Sign In for Pricing
View Details
Human VWC2L activation kit by CRISPRa
GA118356 1 Kit

Human VWC2L activation kit by CRISPRa

Sign In for Pricing
View Details
Sodium O,O-Diisopropyl Dithiophosphate
TRC-D867545-10G 10 g

Sodium O,O-Diisopropyl Dithiophosphate

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (C66/1260), CF740 conjugate, 0.1mg/mL
BNC741260-100 1x 100 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/1260), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1,9-Decadiene
TRC-D210515-250MG 250 mg

1,9-Decadiene

Sign In for Pricing
View Details
Rabbit Polyclonal Antibody
TA397292S 25 µL

Rabbit Polyclonal Antibody

Sign In for Pricing
View Details