Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Corynebacterium glutamicum Uncharacterized membrane protein Cgl2017/cg2211 (Cgl2017, cg2211)

This Recombinant Corynebacterium glutamicum Uncharacterized membrane protein Cgl2017/cg2211 (Cgl2017, cg2211) spans the amino acid sequence from region 1-147.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein Cgl2017/cg2211, P20

UniProt

Q8NP09

Expression Region

1-147

Origin

Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGSSHTIEPEIYRGVSTLDEPSAAWGWHGLKRNTIQLAGWISVLFMLGYNFGNHKGHVE TIWLLVITALLVIGLLIHLFEPKLSQVRTITSRNKPVGHVEPDWTYDQATLTGTWGNLTD SQLRSVNIEPSRVAHLRAADSAKELDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 18 (KRT18) (rKRT18/1190), CF568 conjugate, 0.1mg/mL
BNC683217-500 1x 500 µL

Cytokeratin 18 (KRT18) (rKRT18/1190), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cenps Mouse Gene Knockout Kit (CRISPR)
KN501399 1 Kit

Cenps Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Chlorophenylboronic Acid
TRC-C376510-500MG 500 mg

2-Chlorophenylboronic Acid

Sign In for Pricing
View Details
Human Seprase/FAP ELISA Kit
EA100645 96 Well

Human Seprase/FAP ELISA Kit

Sign In for Pricing
View Details
AMPK alpha 1 (PRKAA1) Human Gene Knockout Kit (CRISPR)
KN218572RB 1 Kit

AMPK alpha 1 (PRKAA1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-(1H-Pyrazol-4-yl)aniline
TRC-B530200-10MG 10 mg

2-(1H-Pyrazol-4-yl)aniline

Sign In for Pricing
View Details