Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida UPF0208 membrane protein PM0703 (PM0703)

This Recombinant Pasteurella multocida UPF0208 membrane protein PM0703 (PM0703) spans the amino acid sequence from region 1-147.

Product Specifications

Product Name Alternative

UPF0208 membrane protein PM0703

UniProt

Q9CMV2

Expression Region

1-147

Origin

Pasteurella multocida (strain Pm70)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYFFIFLKKGQHYLKSWPLESKLGMIFPENRVIKATLFAQKFMPFLAVFAITWQQVYAKS DISALAIAVFSAIVALLIPLQGLYWLGKRSITPLSPQSAVWFYEICERLKQVNETLPILT EQPNYQNLADVLKKAQRKLDKAFWQEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(4-Benzylpiperazin-1-yl)acetic Acid Ethyl Ester-d8
TRC-B286582-5MG 5 mg

(4-Benzylpiperazin-1-yl)acetic Acid Ethyl Ester-d8

Sign In for Pricing
View Details
Recombinant Elongation Factor 1A1 Antibody
RC-5692-01 50 μL

Recombinant Elongation Factor 1A1 Antibody

Sign In for Pricing
View Details
Recombinant Elongation Factor 1A1 Antibody
RC-5692-02 100 µL

Recombinant Elongation Factor 1A1 Antibody

Sign In for Pricing
View Details
Recombinant Elongation Factor 1A1 Antibody
RC-5692-03 1 mL

Recombinant Elongation Factor 1A1 Antibody

Sign In for Pricing
View Details
Diethyl Itaconate-13C5
TRC-D304282-5MG 5 mg

Diethyl Itaconate-13C5

Sign In for Pricing
View Details
1,2-Diethylnaphthalene
TRC-D478120-10MG 10 mg

1,2-Diethylnaphthalene

Sign In for Pricing
View Details