Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida UPF0208 membrane protein PM0703 (PM0703)

This Recombinant Pasteurella multocida UPF0208 membrane protein PM0703 (PM0703) spans the amino acid sequence from region 1-147.

Product Specifications

Product Name Alternative

UPF0208 membrane protein PM0703

UniProt

Q9CMV2

Expression Region

1-147

Origin

Pasteurella multocida (strain Pm70)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYFFIFLKKGQHYLKSWPLESKLGMIFPENRVIKATLFAQKFMPFLAVFAITWQQVYAKS DISALAIAVFSAIVALLIPLQGLYWLGKRSITPLSPQSAVWFYEICERLKQVNETLPILT EQPNYQNLADVLKKAQRKLDKAFWQEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Supt3 Mouse Gene Knockout Kit (CRISPR)
KN516990 1 Kit

Supt3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SULT1B1 Human Gene Knockout Kit (CRISPR)
KN403053 1 Kit

SULT1B1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL
BNC400181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometriotic tissue
CS637422 5x 5 µm

Frozen Tissue Sections, Endometriotic tissue

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS803793 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Histone H3 Recombinant Mouse monoclonal Antibody
HA610203 100 µg

Histone H3 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details