Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized membrane protein YBR224W (YBR224W)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized membrane protein YBR224W (YBR224W) spans the amino acid sequence from region 25-171.

Product Specifications

Product Name Alternative

Putative uncharacterized membrane protein YBR224W

UniProt

P38320

Expression Region

25-171

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ISALYLTLFHRCATFSATSDLFLLVPLKFVSRDINDRLKTHYHHSCLGSPFLCIIFLFIS PLLNYHFRSLVRPPKIHQKGSIPTLTKNAETRCSHHLKQAAATGEVCKVVVIIKGHILKD CSIFFFIIFPLIYPLFINCSSKYNGLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS705025 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
CDC42SE2 Mouse Monoclonal Antibody [Clone ID: OTI10A5]
CF808200 100 µg

CDC42SE2 Mouse Monoclonal Antibody [Clone ID: OTI10A5]

Sign In for Pricing
View Details
Serotonin-13C215N Hydrochloride (~90%)
TRC-S274984-5MG 5 mg

Serotonin-13C215N Hydrochloride (~90%)

Sign In for Pricing
View Details
3-Butylphthalide
TRC-B693850-25G 25 g

3-Butylphthalide

Sign In for Pricing
View Details
2,4-Dichlorobenzoyl Chloride
TRC-D431715-250G 250 g

2,4-Dichlorobenzoyl Chloride

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human HLA-A, B, C Antibody[W6/32]
E-AB-F1130M1-01 20 Tests

Elab Fluor® 700 Anti-Human HLA-A, B, C Antibody[W6/32]

Sign In for Pricing
View Details