Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Inner membrane protein yccF (yccF)

This Recombinant Escherichia coli Inner membrane protein yccF (yccF) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

Inner membrane protein yccF

UniProt

P0AB12

Expression Region

1-148

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRTVLNILNFVLGGFATTLGWLLATLVSIVLIFTLPLTRSCWEITKLSLVPYGNEAIHVD ELNPAGKNVLLNTGGTVLNIFWLIFFGWWLCLMHIATGIAQCISIIGIPVGIANFKIAAI ALWPVGRRVVSVETAQAAREANARRRFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL
BNC741050-100 1x 100 µL

CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL
BNC040676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL
BNC740017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF594 conjugate, 0.1mg/mL
BNC941035-100 1x 100 µL

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1467), CF647 conjugate, 0.1mg/mL
BNC471467-500 1x 500 µL

MCM7 (Proliferation Marker) (MCM7/1467), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 6 (MUC6) (CLH5), CF740 conjugate, 0.1mg/mL
BNC740891-500 1x 500 µL

Mucin 6 (MUC6) (CLH5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details