Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yccF (yccF)

This Recombinant Inner membrane protein yccF (yccF) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

Inner membrane protein yccF

UniProt

P0AB13

Expression Region

1-148

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRTVLNILNFVLGGFATTLGWLLATLVSIVLIFTLPLTRSCWEITKLSLVPYGNEAIHVD ELNPAGKNVLLNTGGTVLNIFWLIFFGWWLCLMHIATGIAQCISIIGIPVGIANFKIAAI ALWPVGRRVVSVETAQAAREANARRRFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44v4 (Marker of Tumor Metastasis), 1mg/mL
BNUM1751-50 1x 50 µL

CD44v4 (Marker of Tumor Metastasis), 1mg/mL

Sign In for Pricing
View Details
Annexin A10 (ANXA10) (NM_007193) Human Over-expression Lysate
LY402103 100 µg

Annexin A10 (ANXA10) (NM_007193) Human Over-expression Lysate

Sign In for Pricing
View Details
CD166 (ALCAM) Rabbit Polyclonal Antibody
TA361190 100 µL

CD166 (ALCAM) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human β-EPR (Beta-Endorphin Receptor) CLIA Kit
E-CL-H0445-01 24 Tests

Human β-EPR (Beta-Endorphin Receptor) CLIA Kit

Sign In for Pricing
View Details
Human β-EPR (Beta-Endorphin Receptor) CLIA Kit
E-CL-H0445-02 48 Tests

Human β-EPR (Beta-Endorphin Receptor) CLIA Kit

Sign In for Pricing
View Details
Human β-EPR (Beta-Endorphin Receptor) CLIA Kit
E-CL-H0445-03 96 Tests

Human β-EPR (Beta-Endorphin Receptor) CLIA Kit

Sign In for Pricing
View Details