Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yccF (yccF)

This Recombinant Inner membrane protein yccF (yccF) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

Inner membrane protein yccF

UniProt

P0AB13

Expression Region

1-148

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRTVLNILNFVLGGFATTLGWLLATLVSIVLIFTLPLTRSCWEITKLSLVPYGNEAIHVD ELNPAGKNVLLNTGGTVLNIFWLIFFGWWLCLMHIATGIAQCISIIGIPVGIANFKIAAI ALWPVGRRVVSVETAQAAREANARRRFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF3D Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G10]
TA808188AM 100 µL

EIF3D Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G10]

Sign In for Pricing
View Details
Caspase-1 Antibody
KC-40238-01 50 μL

Caspase-1 Antibody

Sign In for Pricing
View Details
Caspase-1 Antibody
KC-40238-02 100 µL

Caspase-1 Antibody

Sign In for Pricing
View Details
Caspase-1 Antibody
KC-40238-03 1 mL

Caspase-1 Antibody

Sign In for Pricing
View Details
OR10V1 (C-term) Rabbit Polyclonal Antibody
AP53013PU-N 400 µL

OR10V1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Perfluorobutylsulphonamide
TRC-P303350-50MG 50 mg

Perfluorobutylsulphonamide

Sign In for Pricing
View Details