Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yomK (yomK)

This Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yomK (yomK) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived uncharacterized protein yomK

UniProt

O31974

Expression Region

1-148

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFNKKVLKHNLAEMNPKELIKFIKHEFPINGQDYHTHARKVQIIKSLSPSELSSAIARME GIKSQYDPSKTWGIGSLILGTSFIGFQVLFGVNISKITEGNRLNALIYVLITIIICLWTL RNIIKDKENATTADYLKELLIQIKSEKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

trxA Mouse Monoclonal Antibody [Clone ID: N245/44]
75-258 100 µL

trxA Mouse Monoclonal Antibody [Clone ID: N245/44]

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker), 0.2mg/mL
BNUB1684-100 1x 100 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant Rat MMP-9 Protein (His Tag)
PKSR030381 50 µg

Recombinant Rat MMP-9 Protein (His Tag)

Sign In for Pricing
View Details
Flazasulfuron
TRC-F373550-50MG 50 mg

Flazasulfuron

Sign In for Pricing
View Details
Wilms Tumor Protein Antibody
KC-3022-01 50 μL

Wilms Tumor Protein Antibody

Sign In for Pricing
View Details
Wilms Tumor Protein Antibody
KC-3022-02 100 µL

Wilms Tumor Protein Antibody

Sign In for Pricing
View Details