Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yomK (yomK)

This Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yomK (yomK) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived uncharacterized protein yomK

UniProt

O31974

Expression Region

1-148

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFNKKVLKHNLAEMNPKELIKFIKHEFPINGQDYHTHARKVQIIKSLSPSELSSAIARME GIKSQYDPSKTWGIGSLILGTSFIGFQVLFGVNISKITEGNRLNALIYVLITIIICLWTL RNIIKDKENATTADYLKELLIQIKSEKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LC3B Antibody (MAP1LC3B)
F46115-0.4ML 0.4 mL

LC3B Antibody (MAP1LC3B)

Sign In for Pricing
View Details
2,4-Dinitrophenylhydrazine Hydrochloride
TRC-D481083-500MG 500 mg

2,4-Dinitrophenylhydrazine Hydrochloride

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS500168 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
Recombinant Human HMGB1/HMG1 Protein (His Tag)
PKSH031684-01 100 µg

Recombinant Human HMGB1/HMG1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human HMGB1/HMG1 Protein (His Tag)
PKSH031684-02 500 µg

Recombinant Human HMGB1/HMG1 Protein (His Tag)

Sign In for Pricing
View Details
Ensconsin (MAP7) (NM_001198617) Human Over-expression Lysate
LC434356 20 µg

Ensconsin (MAP7) (NM_001198617) Human Over-expression Lysate

Sign In for Pricing
View Details