Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yomK (yomK)

This Recombinant Bacillus subtilis SPBc2 prophage-derived uncharacterized protein yomK (yomK) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

SPBc2 prophage-derived uncharacterized protein yomK

UniProt

O31974

Expression Region

1-148

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFNKKVLKHNLAEMNPKELIKFIKHEFPINGQDYHTHARKVQIIKSLSPSELSSAIARME GIKSQYDPSKTWGIGSLILGTSFIGFQVLFGVNISKITEGNRLNALIYVLITIIICLWTL RNIIKDKENATTADYLKELLIQIKSEKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dibenzothiophene 5-Oxide
TRC-D423125-10MG 10 mg

Dibenzothiophene 5-Oxide

Sign In for Pricing
View Details
BD14 Mouse
OM297020-01 20 µg

BD14 Mouse

Sign In for Pricing
View Details
BD14 Mouse
OM297020-02 5 µg

BD14 Mouse

Sign In for Pricing
View Details
BD14 Mouse
OM297020-03 1 mg

BD14 Mouse

Sign In for Pricing
View Details
Human ST20 activation kit by CRISPRa
GA118268 1 Kit

Human ST20 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS625687 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details