Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse RING finger protein 24 (Rnf24)

This Recombinant Mouse RING finger protein 24 (Rnf24) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

RING finger protein 24

UniProt

Q8BGI1

Expression Region

1-148

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAVFVFILSLLFCCYLIRLRHQAHKEFYAY KQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLVKWLEVRKVCPLCNM PVLQLAQLHSKQDRGPPQEPLPGAENIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Bromofuran
TRC-B684510-2.5G 2.5 g

3-Bromofuran

Sign In for Pricing
View Details
Human Papillomavirus 16 (HPV-16) (CAMVIR-1), CF488A conjugate, 0.1mg/mL
BNC880502-500 1x 500 µL

Human Papillomavirus 16 (HPV-16) (CAMVIR-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PATE2 (NM_212555) Human Over-expression Lysate
LY403898 100 µg

PATE2 (NM_212555) Human Over-expression Lysate

Sign In for Pricing
View Details
Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Mouse IgG3,  10nm
GM-303-10 1 mL

Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Mouse IgG3, 10nm

Sign In for Pricing
View Details
SHC (SHC1) (C-term) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 11F6]
AM00140PU-N 100 µg

SHC (SHC1) (C-term) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 11F6]

Sign In for Pricing
View Details
ITGB1BP2 Antibody
KC-3513-01 50 μL

ITGB1BP2 Antibody

Sign In for Pricing
View Details