Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse RING finger protein 24 (Rnf24)

This Recombinant Mouse RING finger protein 24 (Rnf24) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

RING finger protein 24

UniProt

Q8BGI1

Expression Region

1-148

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAVFVFILSLLFCCYLIRLRHQAHKEFYAY KQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLVKWLEVRKVCPLCNM PVLQLAQLHSKQDRGPPQEPLPGAENIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44v4 (Marker of Tumor Metastasis) (CD44v4/1700R), CF405S conjugate, 0.1mg/mL
BNC041700-100 1x 100 µL

CD44v4 (Marker of Tumor Metastasis) (CD44v4/1700R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SDS Human Gene Knockout Kit (CRISPR)
KN417814 1 Kit

SDS Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FITC Mouse IgG3, κ Isotype Control[A112-3]
E-AB-F09752C-01 20 Tests

FITC Mouse IgG3, κ Isotype Control[A112-3]

Sign In for Pricing
View Details
FITC Mouse IgG3, κ Isotype Control[A112-3]
E-AB-F09752C-02 100 Tests

FITC Mouse IgG3, κ Isotype Control[A112-3]

Sign In for Pricing
View Details
FITC Mouse IgG3, κ Isotype Control[A112-3]
E-AB-F09752C-03 2x 100 Tests

FITC Mouse IgG3, κ Isotype Control[A112-3]

Sign In for Pricing
View Details
Human DDX53 activation kit by CRISPRa
GA116168 1 Kit

Human DDX53 activation kit by CRISPRa

Sign In for Pricing
View Details