Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse RING finger protein 24 (Rnf24)

This Recombinant Mouse RING finger protein 24 (Rnf24) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

RING finger protein 24

UniProt

Q8BGI1

Expression Region

1-148

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAVFVFILSLLFCCYLIRLRHQAHKEFYAY KQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLVKWLEVRKVCPLCNM PVLQLAQLHSKQDRGPPQEPLPGAENIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Esm1 (NM_023612) Mouse Tagged ORF Clone
MG201704 10 µg

Esm1 (NM_023612) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CLPTM1L (C-term) Rabbit Polyclonal Antibody
AP50975PU-N 400 µL

CLPTM1L (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ubiquitin (Autophagy Marker) (UBB/1748), 1mg/mL
BNUM1748-50 1x 50 µL

Ubiquitin (Autophagy Marker) (UBB/1748), 1mg/mL

Sign In for Pricing
View Details
ZFAND5 (NM_001102421) Human Over-expression Lysate
LC420148 20 µg

ZFAND5 (NM_001102421) Human Over-expression Lysate

Sign In for Pricing
View Details
HIF 2 alpha (EPAS1) Human Gene Knockout Kit (CRISPR)
KN208604 1 Kit

HIF 2 alpha (EPAS1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rifampicin-d8
TRC-R508003-2.5MG 2.5 mg

Rifampicin-d8

Sign In for Pricing
View Details