Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RING finger protein 24 (RNF24)

This Recombinant Human RING finger protein 24 (RNF24) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

RING finger protein 24

UniProt

Q9Y225

Expression Region

1-148

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCCYLIRLRHQAHKEFYAY KQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNM PVLQLAQLHSKQDRGPPQGPLPGAENIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STARD4 Human Gene Knockout Kit (CRISPR)
KN423123 1 Kit

STARD4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Fam166c Mouse Gene Knockout Kit (CRISPR)
KN500051 1 Kit

Fam166c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Protein Lysate, Lung
CP565539 150 µg

Tissue Protein Lysate, Lung

Sign In for Pricing
View Details
Variable Volume 12 Channel Micropipette BPIP-319
BPIP-319 1 Unit

Variable Volume 12 Channel Micropipette BPIP-319

Sign In for Pricing
View Details
COMTD1 (NM_144589) Human Recombinant Protein
TP308412L 1 mg

COMTD1 (NM_144589) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Plek activation kit by CRISPRa
GA205852 1 Kit

Mouse Plek activation kit by CRISPRa

Sign In for Pricing
View Details