Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RING finger protein 24 (RNF24)

This Recombinant Human RING finger protein 24 (RNF24) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

RING finger protein 24

UniProt

Q9Y225

Expression Region

1-148

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCCYLIRLRHQAHKEFYAY KQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNM PVLQLAQLHSKQDRGPPQGPLPGAENIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HGF (C-term) Rabbit Polyclonal Antibody
AP11675PU-N 400 µL

HGF (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ABL1 Recombinant Rabbit Monoclonal Antibody [PSH04-08]
HA722089 100 µL

ABL1 Recombinant Rabbit Monoclonal Antibody [PSH04-08]

Sign In for Pricing
View Details
Myoglobin (Muscle Cell Marker) (rMB/2105), CF647 conjugate, 0.1mg/mL
BNC473800-100 1x 100 µL

Myoglobin (Muscle Cell Marker) (rMB/2105), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine5.5 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09843I-01 25 µg

PE/Cyanine5.5 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
PE/Cyanine5.5 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09843I-02 100 µg

PE/Cyanine5.5 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
SLAMF7 (NM_021181) Human Over-expression Lysate
LY402852 100 µg

SLAMF7 (NM_021181) Human Over-expression Lysate

Sign In for Pricing
View Details