Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RING finger protein 24 (RNF24)

This Recombinant Human RING finger protein 24 (RNF24) spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

RING finger protein 24

UniProt

Q9Y225

Expression Region

1-148

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCCYLIRLRHQAHKEFYAY KQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNM PVLQLAQLHSKQDRGPPQGPLPGAENIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Live or Dead™ Fixable Dead Cell Staining Kit *Blue Fluorescence with 405 nm Excitation*
22500-AAT 200 Tests

Live or Dead™ Fixable Dead Cell Staining Kit *Blue Fluorescence with 405 nm Excitation*

Sign In for Pricing
View Details
Human CCZ1B activation kit by CRISPRa
GA116652 1 Kit

Human CCZ1B activation kit by CRISPRa

Sign In for Pricing
View Details
Diglycolic anhydride
TRC-D446338-250MG 250 mg

Diglycolic anhydride

Sign In for Pricing
View Details
N-Hexadecanoyl-4-Hydroxyproline
TRC-H293848-5MG 5 mg

N-Hexadecanoyl-4-Hydroxyproline

Sign In for Pricing
View Details
ARMC5 (NM_001301820) Human Tagged ORF Clone
RG239833 10 µg

ARMC5 (NM_001301820) Human Tagged ORF Clone

Sign In for Pricing
View Details
CCDC102A (C-term) Rabbit Polyclonal Antibody
AP50756PU-N 400 µL

CCDC102A (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details