Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Panax ginseng CASP-like protein 1

This Recombinant Panax ginseng CASP-like protein 1 spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

CASP-like protein 1

UniProt

Q20BM9

Expression Region

1-148

Origin

Panax ginseng (Korean ginseng)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVTGKQTELIPIPFPPYQIPYSSKFTDSPAFIYFVAAFSVAGLYSIITSLLSGLALLKPG YAKQLVSHFVVVDVLLLGIVAAAIGAAGGVGYIGLRGNSHSRWTKICNIYDTFCQHLAGS IAAGLIASIVLVLLILLSFFTLSRKIPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Bub1b activation kit by CRISPRa
GA200454 1 Kit

Mouse Bub1b activation kit by CRISPRa

Sign In for Pricing
View Details
Prodan
TRC-P755865-50MG 50 mg

Prodan

Sign In for Pricing
View Details
CD45 / LCA (Leucocyte Marker) (PTPRC/1147 + PTPRC/1460), 0.2mg/mL
BNUB2027-100 1x 100 µL

CD45 / LCA (Leucocyte Marker) (PTPRC/1147 + PTPRC/1460), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant Human TAPBP/ Tapasin Protein (His Tag)
PKSH030545 100 µg

Recombinant Human TAPBP/ Tapasin Protein (His Tag)

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2615), CF647 conjugate, 0.1mg/mL
BNC472615-100 1x 100 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2615), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant NQO2 Antibody
RC-16666-01 50 μL

Recombinant NQO2 Antibody

Sign In for Pricing
View Details