Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Panax ginseng CASP-like protein 1

This Recombinant Panax ginseng CASP-like protein 1 spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

CASP-like protein 1

UniProt

Q20BM9

Expression Region

1-148

Origin

Panax ginseng (Korean ginseng)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVTGKQTELIPIPFPPYQIPYSSKFTDSPAFIYFVAAFSVAGLYSIITSLLSGLALLKPG YAKQLVSHFVVVDVLLLGIVAAAIGAAGGVGYIGLRGNSHSRWTKICNIYDTFCQHLAGS IAAGLIASIVLVLLILLSFFTLSRKIPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Mouse CD86 Antibody[GL-1]
E-AB-F0994A-01 25 µg

Purified Anti-Mouse CD86 Antibody[GL-1]

Sign In for Pricing
View Details
Purified Anti-Mouse CD86 Antibody[GL-1]
E-AB-F0994A-02 100 µg

Purified Anti-Mouse CD86 Antibody[GL-1]

Sign In for Pricing
View Details
VCP Recombinant Rabbit Monoclonal Antibody [JM11-15]
ET1703-56 100 µL

VCP Recombinant Rabbit Monoclonal Antibody [JM11-15]

Sign In for Pricing
View Details
ZNF8 Mouse Monoclonal Antibody [Clone ID: OTI3E5]
CF811987 100 µg

ZNF8 Mouse Monoclonal Antibody [Clone ID: OTI3E5]

Sign In for Pricing
View Details
Centrifuge Tubes
C2603 500 Units/Case

Centrifuge Tubes

Sign In for Pricing
View Details
Recombinant Human SULT2B1 Protein (His Tag)
PKSH033369-01 10 µg

Recombinant Human SULT2B1 Protein (His Tag)

Sign In for Pricing
View Details