Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Panax ginseng CASP-like protein 1

This Recombinant Panax ginseng CASP-like protein 1 spans the amino acid sequence from region 1-148.

Product Specifications

Product Name Alternative

CASP-like protein 1

UniProt

Q20BM9

Expression Region

1-148

Origin

Panax ginseng (Korean ginseng)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVTGKQTELIPIPFPPYQIPYSSKFTDSPAFIYFVAAFSVAGLYSIITSLLSGLALLKPG YAKQLVSHFVVVDVLLLGIVAAAIGAAGGVGYIGLRGNSHSRWTKICNIYDTFCQHLAGS IAAGLIASIVLVLLILLSFFTLSRKIPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cip4 (TRIP10) Human Gene Knockout Kit (CRISPR)
KN401200 1 Kit

Cip4 (TRIP10) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Digitoxin-21,23,23-d3
TRC-D445952-5MG 5 mg

Digitoxin-21,23,23-d3

Sign In for Pricing
View Details
GABRR1 Human Gene Knockout Kit (CRISPR)
KN417506 1 Kit

GABRR1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker), CF640R conjugate, 0.1mg/mL
BNC401665-100 1x 100 µL

Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79b (B-Cell Marker) (IGB/1843), 1mg/mL
BNUM1843-50 1x 50 µL

CD79b (B-Cell Marker) (IGB/1843), 1mg/mL

Sign In for Pricing
View Details
Patritumab Biosimilar - Research Grade
ICH5206-10mg 10 mg (2x 5 mg)

Patritumab Biosimilar - Research Grade

Sign In for Pricing
View Details